быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HLA-G Rabbit mAb (A24425)
- Описание
- Характеристики
-
Overview
Product name HLA-G Rabbit mAb Catalog No. A24425 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC63292 Background
HLA-G belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-G is expressed on fetal derived placental cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exon 6 encodes the cytoplasmic tail.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HLA-G (NP_002118.1). Sequence GYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLAL Gene ID Swiss Prot Synonyms MHC-G Calculated MW 38kDa Observed MW 30-40kDa Applications
Reactivity Human Tested applications WB IF/ICC Recommended dilution - WB 1:5000 - 1:10000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293T transfected with HLA-G Cellular location Membrane, Single-pass type I membrane protein 
Western blot analysis of extracts of normal 293T cells and 293T transfected with HLA-G-His-C protein, using HLA-G Rabbit mAb (A24425) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.3s.
Confocal imaging of 293F-HLA-G and 293F cells cells using HLA-G Rabbit mAb (A24425, dilution 1:200)(Red). DAPI was used for nuclear staining (blue). Objective: 100x.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HLA-G (NP_002118.1). Isotype IgG