быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
FNTB Rabbit mAb (A2611)
- Описание
- Характеристики
-
Overview
Product name FNTB Rabbit mAb Catalog No. A2611 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1923 Background
Enables zinc ion binding activity. Contributes to protein farnesyltransferase activity. Involved in protein farnesylation. Part of microtubule associated complex and protein farnesyltransferase complex.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FNTB (P49356). Sequence MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASR Gene ID Swiss Prot Synonyms FPTB Calculated MW 49kDa Observed MW 49kDa Applications
Reactivity Human, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, 293T, A-431, Rat brain Cellular location cytosol, protein farnesyltransferase complex 
Western blot analysis of extracts of various cell lines, using FNTB Rabbit mAb (A2611) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded rat spleen using FNTB Rabbit mAb (A2611) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FNTB (P49356). Isotype IgG