быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Cytokeratin 2e (KRT2) Rabbit mAb (A2615)
- Описание
- Характеристики
-
Overview
Product name Cytokeratin 2e (KRT2) Rabbit mAb Catalog No. A2615 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1925 Background
The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is expressed largely in the upper spinous layer of epidermal keratinocytes and mutations in this gene have been associated with bullous congenital ichthyosiform erythroderma. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 293-422 of humanKRT2(P35908). Sequence YMIKVELQSKVDLLNQEIEFLKVLYDAEISQIHQSVTDTNVILSMDNSRNLDLDSIIAEVKAQYEEIAQRSKEEAEALYHSKYEELQVTVGRHGDSLKEIKIEISELNRVIQRLQGEIAHVKKQCKNVQD Gene ID Swiss Prot Synonyms K2e; KRTE; CK-2e; KRT2A; KRT2E Calculated MW 65kDa Observed MW 65kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples A-431 Cellular location cytoplasm, cytosol, extracellular exosome, extracellular space, nucleus 
Western blot analysis of extracts of A-431 cells, using Cytokeratin 2e (KRT2) antibody (A2615) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded mouse skin using Cytokeratin 2e (KRT2) Rabbit mAb (A2615) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of rat skin using Cytokeratin 2e (KRT2) Rabbit mAb (A2615) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of human skin using Cytokeratin 2e (KRT2) Rabbit mAb (A2615) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse skin using Cytokeratin 2e (KRT2) Rabbit mAb (A2615) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 293-422 of humanKRT2(P35908). Isotype IgG