быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TFAM Rabbit mAb (A3173)
- Описание
- Характеристики
-
Overview
Product name TFAM Rabbit mAb Catalog No. A3173 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51776 Background
This gene encodes a key mitochondrial transcription factor containing two high mobility group motifs. The encoded protein also functions in mitochondrial DNA replication and repair. Sequence polymorphisms in this gene are associated with Alzheimer's and Parkinson's diseases. There are pseudogenes for this gene on chromosomes 6, 7, and 11. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TFAM (NP_003192.1). Sequence QDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELY Gene ID Swiss Prot Synonyms TCF6; MTTF1; MTTFA; TCF6L1; TCF6L2; TCF6L3; MTDPS15 Calculated MW 29kDa Observed MW 24kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:1000 - 1:10000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, HepG2, Mouse thymus, Rat heart Cellular location Mitochondrion, Mitochondrion matrix, mitochondrion nucleoid Customer validation IF(Homo sapiens)
WB(Mus musculus, Homo sapiens)
Western blot analysis of various lysates, using TFAM Rabbit pAb (A3173) at 1:6000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using TFAM Rabbit mAb (A3173) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human lung using TFAM Rabbit mAb (A3173) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat ovary using TFAM Rabbit mAb (A3173) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TFAM (NP_003192.1). Isotype IgG