быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CLPP Rabbit mAb (A3214)
- Описание
- Характеристики
-
Overview
Product name CLPP Rabbit mAb Catalog No. A3214 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1929 Background
The protein encoded by this gene belongs to the peptidase family S14 and hydrolyzes proteins into small peptides in the presence of ATP and magnesium. The protein is transported into mitochondrial matrix and is associated with the inner mitochondrial membrane.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 178-277 of human CLPP (Q16740). Sequence HQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST Gene ID Swiss Prot Synonyms DFNB81; PRLTS3 Calculated MW 30kDa Observed MW 26kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, SW620, Hep G2, Mouse liver, Mouse heart, Rat liver Cellular location Mitochondrion matrix 
Western blot analysis of extracts of various cell lines, using CLPP Rabbit mAb (A3214) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded rat kidney using CLPP Rabbit mAb (A3214) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon using CLPP Rabbit mAb (A3214) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH/3T3 cells using CLPP Rabbit mAb (A3214) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 178-277 of human CLPP (Q16740). Isotype IgG