быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CBX2 Rabbit mAb (A3294)
- Описание
- Характеристики
-
Overview
Product name CBX2 Rabbit mAb Catalog No. A3294 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1939 Background
This gene encodes a component of the polycomb multiprotein complex, which is required to maintain the transcriptionally repressive state of many genes throughout development via chromatin remodeling and modification of histones. Disruption of this gene in mice results in male-to-female gonadal sex reversal. Mutations in this gene are also associated with gonadal dysgenesis in humans. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 433-532 of human CBX2 (Q14781). Sequence GSATPSGQESRTAPGEARKAATLPEMSAGEESSSSDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVTVKESPTSVGFFNLRHY Gene ID Swiss Prot Synonyms M33; CDCA6; SRXY5 Calculated MW 56kDa Observed MW 56kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HT-29, 293T, Mouse liver, Mouse testis, Mouse brain, Rat testis Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using CBX2 Rabbit mAb (A3294) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 433-532 of human CBX2 (Q14781). Isotype IgG