быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
E2F2 Rabbit mAb (A3297)
- Описание
- Характеристики
-
Overview
Product name E2F2 Rabbit mAb Catalog No. A3297 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1940 Background
The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 303-395 of human E2F2 (Q14209). Sequence CPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAPPPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLA Gene ID Swiss Prot Synonyms E2F-2 Calculated MW 48kDa Observed MW 50kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, SH-SY5Y, Mouse lung, Mouse thymus Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using E2F2 Rabbit mAb (A3297) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 303-395 of human E2F2 (Q14209). Isotype IgG







