быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Lipin 1 Rabbit mAb (A3326)
- Описание
- Характеристики
-
Overview
Product name Lipin 1 Rabbit mAb Catalog No. A3326 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1945 Background
This gene encodes a magnesium-ion-dependent phosphatidic acid phosphohydrolase enzyme that catalyzes the penultimate step in triglyceride synthesis including the dephosphorylation of phosphatidic acid to yield diacylglycerol. Expression of this gene is required for adipocyte differentiation and it also functions as a nuclear transcriptional coactivator with some peroxisome proliferator-activated receptors to modulate expression of other genes involved in lipid metabolism. Mutations in this gene are associated with metabolic syndrome, type 2 diabetes, acute recurrent rhabdomyolysis, and autosomal recessive acute recurrent myoglobinuria (ARARM). This gene is also a candidate for several human lipodystrophy syndromes.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human Lipin 1 (Q14693). Sequence MHLATSPILSEGASRMECQLKRGSVDRMRGLDPSTPAQVIAPSETPSSSSVVKKRRKRRRKSQLDSLKRDDNMNTSEDEDMFPIEMSSDEAMELLESSRT Gene ID Swiss Prot Synonyms PAP1 Calculated MW 99kDa Observed MW 130kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, Hep G2, NIH/3T3, RD, Mouse testis, Rat testis Cellular location Cytoplasm, Endoplasmic reticulum membrane, Nucleus membrane, Cytosol 
Western blot analysis of extracts of various cell lines, using Lipin 1 Rabbit mAb (A3326) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human Lipin 1 (Q14693). Isotype IgG







