быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
LSP1 Rabbit mAb (A3355)
- Описание
- Характеристики
-
Overview
Product name LSP1 Rabbit mAb Catalog No. A3355 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1952 Background
This gene encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Alternative splicing results in multiple transcript variants encoding different isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 240-339 of human LSP1 (P33241). Sequence TAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP Gene ID Swiss Prot Synonyms WP34; pp52 Calculated MW 37kDa Observed MW 47kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Raji, Mouse spleen Cellular location Cell membrane, Cytoplasmic side, Peripheral membrane protein 
Western blot analysis of various lysates, using LSP1 Rabbit mAb (A3355) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunofluorescence analysis of Jurkat cells using LSP1 Rabbit mAb (A3355) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of rat spleen using LSP1 Rabbit mAb (A3355) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse spleen using LSP1 Rabbit mAb (A3355) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 240-339 of human LSP1 (P33241). Isotype IgG