быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MIB1/DIP1 Rabbit mAb (A3371)
- Описание
- Характеристики
-
Overview
Product name MIB1/DIP1 Rabbit mAb Catalog No. A3371 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1958 Background
This gene encodes a protein containing multiple ankyrin repeats and RING finger domains that functions as an E3 ubiquitin ligase. The encoded protein positively regulates Notch signaling by ubiquitinating the Notch receptors, thereby facilitating their endocytosis. This protein may also promote the ubiquitination and degradation of death-associated protein kinase 1 (DAPK1).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MIB1/DIP1 (Q86YT6). Sequence MSNSRNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANYRCSGAYDLRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKC Gene ID Swiss Prot Synonyms MIB; DIP1; ZZZ6; DIP-1; LVNC7; ZZANK2 Calculated MW 110kDa Observed MW 110kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, K-562, U-87MG, Mouse lung, Mouse testis, Mouse brain, Rat brain Cellular location Cell membrane, Cytoplasm, centriolar satellite, centrosome, cytoskeleton, microtubule organizing center 
Western blot analysis of extracts of various cell lines, using MIB1/DIP1 Rabbit mAb (A3371) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MIB1/DIP1 (Q86YT6). Isotype IgG