быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Menin Rabbit mAb (A3395)
- Описание
- Характеристики
-
Overview
Product name Menin Rabbit mAb Catalog No. A3395 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1968 Background
This gene encodes menin, a tumor suppressor associated with a syndrome known as multiple endocrine neoplasia type 1. Menin is a scaffold protein that functions in histone modification and epigenetic gene regulation. It is thought to regulate several pathways and processes by altering chromatin structure through the modification of histones.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 516-615 of human Menin (O00255). Sequence VSGPPRKPPGTVAGTARGPEGGSTAQVPAPTASPPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTPSDYTLSFLKRQRKGL Gene ID Swiss Prot Synonyms MEAI; SCG2 Calculated MW 68kDa Observed MW 72kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, HCT 116, Hep G2, NIH/3T3, Mouse lung, Mouse brain, Rat lung, Rat brain Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using Menin Rabbit mAb (A3395) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts of various cell lines, using Menin Rabbit mAb (A3395) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 516-615 of human Menin (O00255). Isotype IgG