быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SNX1 Rabbit mAb (A3398)
- Описание
- Характеристики
-
Overview
Product name SNX1 Rabbit mAb Catalog No. A3398 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1969 Background
This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This endosomal protein regulates the cell-surface expression of epidermal growth factor receptor. This protein also has a role in sorting protease-activated receptor-1 from early endosomes to lysosomes. This protein may form oligomeric complexes with family members. This gene results in three transcript variants encoding distinct isoforms.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SNX1 (Q13596). Sequence MASGGGGCSASERLPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVVSKHQSPKITTSLLPINNGSKENGIHEEQDQEPQDLFADATVELSLDS Gene ID Swiss Prot Synonyms VPS5; HsT17379 Calculated MW 59kDa Observed MW 74kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, Hep G2 Cellular location Cell projection, Cytoplasmic side, Early endosome membrane, Endosome membrane, Golgi apparatus, Peripheral membrane protein, lamellipodium, trans-Golgi network membrane 
Western blot analysis of extracts of various cell lines, using SNX1 Rabbit mAb (A3398) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SNX1 (Q13596). Isotype IgG