быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Phospholipid Scramblase 1 (PLSCR1) Rabbit mAb (A3430)
- Описание
- Характеристики
-
Overview
Product name Phospholipid Scramblase 1 (PLSCR1) Rabbit mAb Catalog No. A3430 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2028 Background
This gene encodes a phospholipid scramblase family member. The encoded protein is involved in disruption of the asymmetrical distribution of phospholipids between the inner and outer leaflets of the plasma membrane, resulting in externalization of phosphatidylserine. This cell membrane disruption plays an important role in the blood coagulation cascade as well as macrophage clearing of apoptotic cells. The encoded protein has additionally been implicated in gene regulation and interferon-induced antiviral responses.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Phospholipid Scramblase 1 (PLSCR1) (NP_066928.1). Sequence MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPPAGHSGPGPAGFPVPNQPVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLE Gene ID Swiss Prot Synonyms MMTRA1B Calculated MW 35kDa Observed MW 35kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HT-29, Mouse lung Cellular location Cell membrane, Nucleus, Cytoplasm, Cytoplasm, perinuclear region 
Western blot analysis of extracts of HT-29 cells, using Phospholipid Phospholipid Scramblase 1 (PLSCR1) (PLSCR1) Rabbit mAb (A3430) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Western blot analysis of extracts of Mouse lung, using Phospholipid Phospholipid Scramblase 1 (PLSCR1) (PLSCR1) Rabbit mAb (A3430) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human breast cancer using Phospholipid Phospholipid Scramblase 1 (PLSCR1) (PLSCR1) Rabbit mAb (A3430) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of C6 cells using Phospholipid Phospholipid Scramblase 1 (PLSCR1) (PLSCR1) Rabbit mAb (A3430) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Phospholipid Scramblase 1 (PLSCR1) (NP_066928.1). Isotype IgG