быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PSMA1 Rabbit mAb (A3460)
- Описание
- Характеристики
-
Overview
Product name PSMA1 Rabbit mAb Catalog No. A3460 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0780 Background
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Alternative splicing results in multiple transcript variants encoding distinct isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 164-263 of human PSMA1 (P25786). Sequence RSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH Gene ID Swiss Prot Synonyms NU; HC2; PROS30; HEL-S-275 Calculated MW 30kDa Observed MW 30kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HepG2, MCF7, U-87MG, Mouse liver, Mouse brain, Mouse spleen, Rat liver, Rat brain, Rat spleen Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using PSMA1 Rabbit mAb (A3460) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunofluorescence analysis of NIH-3T3 cells using PSMA1 Rabbit mAb (A3460) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 164-263 of human PSMA1 (P25786). Isotype IgG