быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PIWIL1 Rabbit mAb (A3490)
- Описание
- Характеристики
-
Overview
Product name PIWIL1 Rabbit mAb Catalog No. A3490 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0786 Background
This gene encodes a member of the PIWI subfamily of Argonaute proteins, evolutionarily conserved proteins containing both PAZ and Piwi motifs that play important roles in stem cell self-renewal, RNA silencing, and translational regulation in diverse organisms. The encoded protein may play a role as an intrinsic regulator of the self-renewal capacity of germline and hematopoietic stem cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 700-800 of human PIWIL1 (Q96J94). Sequence YRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYNPRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN Gene ID Swiss Prot Synonyms HIWI; MIWI; PIWI; CT80.1 Calculated MW 99kDa Observed MW 90kDa Applications
Reactivity Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples Mouse testis, Mouse brain, Rat testis, Rat brain Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using PIWIL1 Rabbit mAb (A3490) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using PIWIL1 Rabbit mAb (A3490) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of mouse testis using PIWIL1 Rabbit mAb (A3490) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 700-800 of human PIWIL1 (Q96J94). Isotype IgG