быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
EHD1 Rabbit mAb (A3496)
- Описание
- Характеристики
-
Overview
Product name EHD1 Rabbit mAb Catalog No. A3496 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2015 Background
This gene belongs to a highly conserved gene family encoding EPS15 homology (EH) domain-containing proteins. The protein-binding EH domain was first noted in EPS15, a substrate for the epidermal growth factor receptor. The EH domain has been shown to be an important motif in proteins involved in protein-protein interactions and in intracellular sorting. The protein encoded by this gene is thought to play a role in the endocytosis of IGF1 receptors. Alternatively spliced transcript variants have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EHD1 (Q9H4M9). Sequence MFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAV Gene ID Swiss Prot Synonyms PAST; PAST1; H-PAST; HPAST1 Calculated MW 61kDa Observed MW 61kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, THP-1, U-251MG, Mouse liver, Mouse brain, Mouse spleen, Rat lung, Rat testis, Rat kidney Cellular location Cell membrane, Cell projection, Cytoplasmic side, Early endosome membrane, Peripheral membrane protein, Recycling endosome membrane, cilium membrane 
Western blot analysis of extracts of various cell lines, using EHD1 Rabbit mAb (A3496) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded human appendix using EHD1 Rabbit mAb (A3496) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EHD1 (Q9H4M9). Isotype IgG