быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CRMP5/DPYSL5 Rabbit mAb (A3503)
- Описание
- Характеристики
-
Overview
Product name CRMP5/DPYSL5 Rabbit mAb Catalog No. A3503 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2020 Background
This gene encodes a member of the CRMP (collapsing response mediator protein) family thought to be involved in neural development. Antibodies to the encoded protein were found in some patients with neurologic symptoms who had paraneoplastic syndrome. A pseudogene of this gene is found on chromosome 11. Multiple alternatively spliced variants, encoding the same protein, have been identified.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 465-564 of human CRMP5/DPYSL5 (Q9BPU6). Sequence RSFPDTVYKKLVQREKTLKVRGVDRTPYLGDVAVVVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSGIW Gene ID Swiss Prot Synonyms CV2; CRAM; CRMP5; RTSC4; Ulip6; CRMP-5 Calculated MW 61kDa Observed MW 60kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples SH-SY5Y, Mouse testis, Rat testis Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using CRMP5/DPYSL5 Rabbit mAb (A3503) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded rat spleen using CRMP5/DPYSL5 Rabbit mAb (A3503) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human appendix using CRMP5/DPYSL5 Rabbit mAb (A3503) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 465-564 of human CRMP5/DPYSL5 (Q9BPU6). Isotype IgG