быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Chromogranin B Rabbit mAb (A3517)
- Описание
- Характеристики
-
Overview
Product name Chromogranin B Rabbit mAb Catalog No. A3517 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2023 Background
This gene encodes a tyrosine-sulfated secretory protein abundant in peptidergic endocrine cells and neurons. This protein may serve as a precursor for regulatory peptides.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 550-650 of human Chromogranin B (P05060). Sequence EEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTE Gene ID Swiss Prot Synonyms SCG1 Calculated MW 78kDa Observed MW 110kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, PC-12, BxPC-3, SH-SY5Y, Mouse brain Cellular location endoplasmic reticulum lumen, extracellular space 
Western blot analysis of extracts of various cell lines, using Chromogranin B antibody (A3517) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts of Mouse brain cells, using Chromogranin B antibody (A3517) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 550-650 of human Chromogranin B (P05060). Isotype IgG







