быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CaMKI Rabbit mAb (A3529)
- Описание
- Характеристики
-
Overview
Product name CaMKI Rabbit mAb Catalog No. A3529 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2030 Background
Calcium/calmodulin-dependent protein kinase I is expressed in many tissues and is a component of a calmodulin-dependent protein kinase cascade. Calcium/calmodulin directly activates calcium/calmodulin-dependent protein kinase I by binding to the enzyme and indirectly promotes the phosphorylation and synergistic activation of the enzyme by calcium/calmodulin-dependent protein kinase I kinase.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CaMKI (NP_003647.1). Sequence MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKEGSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSG Gene ID Swiss Prot Synonyms CAMKI Calculated MW 41kDa Observed MW 41kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Hep G2, Mouse lung, Mouse liver, Rat lung Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using CaMKI Rabbit mAb (A3529) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CaMKI (NP_003647.1). Isotype IgG