быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MELK Rabbit mAb (A3530)
- Описание
- Характеристики
-
Overview
Product name MELK Rabbit mAb Catalog No. A3530 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2032 Background
Enables calcium ion binding activity; non-membrane spanning protein tyrosine kinase activity; and protein serine/threonine kinase activity. Involved in apoptotic process; cell population proliferation; and protein autophosphorylation. Located in cell cortex and plasma membrane.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MELK (NP_055606.1). Sequence MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIIS Gene ID Swiss Prot Synonyms HPK38 Calculated MW 75kDa Observed MW 75kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, Jurkat, K-562, Mouse testis, Rat testis Cellular location Cell membrane, Peripheral membrane protein Customer validation WB(Mus musculus, Homo sapiens)
Western blot analysis of extracts of various cell lines, using MELK Rabbit mAb (A3530) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MELK (NP_055606.1). Isotype IgG