быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
NEK6 Rabbit mAb (A3536)
- Описание
- Характеристики
-
Overview
Product name NEK6 Rabbit mAb Catalog No. A3536 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2034 Background
The protein encoded by this gene is a kinase required for progression through the metaphase portion of mitosis. Inhibition of the encoded protein can lead to apoptosis. This protein also can enhance tumorigenesis by suppressing tumor cell senescence. Several transcript variants encoding a few different isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human NEK6 (Q9HC98). Sequence ETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVH Gene ID Swiss Prot Synonyms SID6-1512 Calculated MW 36kDa Observed MW 35kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples 293T, K-562, Mouse lung, Mouse brain, Rat brain Cellular location Cytoplasm, Nucleus, Nucleus speckle, centrosome, cytoskeleton, microtubule organizing center, spindle pole 
Western blot analysis of extracts of various cell lines, using NEK6 Rabbit mAb (A3536) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.
Western blot analysis of extracts of various cell lines, using NEK6 Rabbit mAb (A3536) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded rat kidney using NEK6 Rabbit mAb (A3536) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human NEK6 (Q9HC98). Isotype IgG