- 100 μL
- 200 μL
- 50 μL
- Описание
- Характеристики
-
Overview
Product name Ikaros Rabbit mAb Catalog No. A3565 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0803 Background
This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding proteins associated with chromatin remodeling. The expression of this protein is restricted to the fetal and adult hemo-lymphopoietic system, and it functions as a regulator of lymphocyte differentiation. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. Most isoforms share a common C-terminal domain, which contains two zinc finger motifs that are required for hetero- or homo-dimerization, and for interactions with other proteins. The isoforms, however, differ in the number of N-terminal zinc finger motifs that bind DNA and in nuclear localization signal presence, resulting in members with and without DNA-binding properties. Only a few isoforms contain the requisite three or more N-terminal zinc motifs that confer high affinity binding to a specific core DNA sequence element in the promoters of target genes. The non-DNA-binding isoforms are largely found in the cytoplasm, and are thought to function as dominant-negative factors. Overexpression of some dominant-negative isoforms have been associated with B-cell malignancies, such as acute lymphoblastic leukemia (ALL).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Ikaros (Q13422). Sequence AEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVISPMYQL Gene ID Swiss Prot Synonyms IK1; LYF1; LyF-1; CVID13; IKAROS; PPP1R92; PRO0758; ZNFN1A1; Hs.54452 Calculated MW 58kDa Observed MW 58kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC IP ChIP CUT&Tag Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
- ChIP 1:20 - 1:200
- CUT&Tag 10⁷ cells /1 μg
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, U-937, Mouse lung Cellular location Cytoplasm, Nucleus, Nucleus 
CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina(RK20265) from 10⁷ K562 cells with 1 μg Ikaros Rabbit mAb (A3565), along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of Ikaros in representative gene loci (MICA), as shown in figure.

Western blot analysis of extracts of various cell lines, using Ikaros Rabbit mAb (A3565) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunofluorescence analysis of Jurkat cells using Ikaros Rabbit mAb (A3565) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Chromatin immunoprecipitation analysis of extracts of K-562 cells, using Ikaros antibody (A3565) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Ikaros (Q13422). Isotype IgG







