быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CoREST/RCOR1 Rabbit mAb (A3568)
- Описание
- Характеристики
-
Overview
Product name CoREST/RCOR1 Rabbit mAb Catalog No. A3568 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2044 Background
This gene encodes a protein that is well-conserved, downregulated at birth, and with a specific role in determining neural cell differentiation. The encoded protein binds to the C-terminal domain of REST (repressor element-1 silencing transcription factor).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CoREST/RCOR1 (Q9UKL0). Sequence MPAMVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAAAPNNGQNKSLAAAAPNGNSSSNSWEEGSSGSSSDEEH Gene ID Swiss Prot Synonyms RCOR; COREST Calculated MW 53kDa Observed MW 65kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IP ChIP Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IP 1:500 - 1:1000
- ChIP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunoprecipitation Positive samples HT-29, HepG2, C2C12 Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using CoREST/RCOR1 Rabbit mAb (A3568) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Western blot analysis of extracts of C2C12 cells, using CoREST/RCOR1 Rabbit mAb (A3568) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded rat lung using CoREST/RCOR1 Rabbit mAb (A3568) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human appendix using CoREST/RCOR1 Rabbit mAb (A3568) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse brain using CoREST/RCOR1 Rabbit mAb (A3568) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunoprecipitation analysis of 300 μg extracts of THP-1 cells using 3 μg CoREST/RCOR1 antibody (A3568). Western blot was performed from the immunoprecipitate using CoREST/RCOR1 antibody (A3568) at a dilution of 1:1000.
Chromatin immunoprecipitation analysis of extracts of HepG2 cells, using CoREST/RCOR1 antibody (A3568) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting, Immunohistochemistry, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CoREST/RCOR1 (Q9UKL0). Isotype IgG