быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SIRT6 Rabbit mAb (A3591)
- Описание
- Характеристики
-
Overview
Product name SIRT6 Rabbit mAb Catalog No. A3591 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0808 Background
This gene encodes a member of the sirtuin family of NAD-dependent enzymes that are implicated in cellular stress resistance, genomic stability, aging and energy homeostasis. The encoded protein is localized to the nucleus, exhibits ADP-ribosyl transferase and histone deacetylase activities, and plays a role in DNA repair, maintenance of telomeric chromatin, inflammation, lipid and glucose metabolism. Alternative splicing results in multiple transcript variants encoding different isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 256-355 of human SIRT6 (Q8N6T7). Sequence GYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS Gene ID Swiss Prot Synonyms SIR2L6; hSIRT6 Calculated MW 39kDa Observed MW 40kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, A549, MCF7 Cellular location Nucleus, Endoplasmic reticulum Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using SIRT6 Rabbit mAb (A3591) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 256-355 of human SIRT6 (Q8N6T7). Isotype IgG