быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD35/CR1 Rabbit mAb (A3661)
- Описание
- Характеристики
-
Overview
Product name CD35/CR1 Rabbit mAb Catalog No. A3661 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2065 Background
This gene is a member of the receptors of complement activation (RCA) family and is located in the 'cluster RCA' region of chromosome 1. The genome is polymorphic at this locus with allele-specific splice variants encoding different isoforms, based on the presence/absence of long homologous repeats (LHRs). The gene encodes a monomeric single-pass type I membrane glycoprotein found on erythrocytes, leukocytes, glomerular podocytes, and splenic follicular dendritic cells. The Knops blood group system is a system of antigens located on this protein. The protein mediates cellular binding to particles and immune complexes that have activated complement. Decreases in expression of this protein and/or mutations in this gene have been associated with gallbladder carcinomas, mesangiocapillary glomerulonephritis, systemic lupus erythematosus, sarcoidosis and Alzheimer's disease. Mutations in this gene have also been associated with a reduction in Plasmodium falciparum rosetting, conferring protection against severe malaria.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1940-2039 of human CD35/CR1 (P17927). Sequence DGYTLEGSPWSQCQADDRWDPPLAKCTSRTHDALIVGTLSGTIFFILLIIFLSWIILKHRKGNNAHENPKEVAIHLHSQGGSSVHPRTLQTNEENSRVLP Gene ID Swiss Prot Synonyms KN; C3BR; C4BR; CD35 Calculated MW 224kDa Observed MW Applications
Reactivity Human, Mouse, Rat Tested applications IHC-P IF/ICC Recommended dilution - IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunohistochemistry Immunofluorescence Positive samples Cellular location Membrane, Single-pass type I membrane protein 
Immunohistochemistry analysis of paraffin-embedded human tonsil using CD35/CR1 Rabbit mAb (A3661) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunofluorescence analysis of THP-1 cells using CD35/CR1 Rabbit mAb (A3661) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of rat spleen using CD35/CR1 Rabbit mAb (A3661) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1940-2039 of human CD35/CR1 (P17927). KO Validated Validated Isotype IgG







