быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PSMD4 Rabbit mAb (A3663)
- Описание
- Характеристики
-
Overview
Product name PSMD4 Rabbit mAb Catalog No. A3663 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0818 Background
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the non-ATPase subunits of the 19S regulator lid. Pseudogenes have been identified on chromosomes 10 and 21.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human PSMD4 (P55036). Sequence TTGTEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNE Gene ID Swiss Prot Synonyms AF; ASF; S5A; AF-1; MCB1; Rpn10; pUB-R5 Calculated MW 41kDa Observed MW 55kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples A549, U-251MG, Mouse testis, Rat brain Cellular location Cytosol, Nucleoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using PSMD4 Rabbit mAb (A3663) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunofluorescence analysis of NIH-3T3 cells using PSMD4 Rabbit mAb (A3663) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human PSMD4 (P55036). Isotype IgG