быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
EAAT2/SLC1A2 Rabbit mAb (A3679)
- Описание
- Характеристики
-
Overview
Product name EAAT2/SLC1A2 Rabbit mAb Catalog No. A3679 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0821 Background
This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Improper regulation of this gene is thought to be associated with several neurological disorders. Alternatively spliced transcript variants of this gene have been identified.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human EAAT2/SLC1A2 (P43004). Sequence KKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNVLGLIGFFI Gene ID Swiss Prot Synonyms GLT1; HBGT; DEE41; EAAT2; GLT-1; EIEE41 Calculated MW 62kDa Observed MW 70kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples U-251MG, U-87MG, Y79, Mouse liver, Mouse brain, Mouse eye, Rat liver, Rat brain Cellular location Membrane 
Western blot analysis of extracts of various cell lines, using EAAT2/SLC1A2 Rabbit mAb (A3679) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human EAAT2/SLC1A2 (P43004). Isotype IgG







