быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Galectin 4/LGALS4 Rabbit mAb (A3691)
- Описание
- Характеристики
-
Overview
Product name Galectin 4/LGALS4 Rabbit mAb Catalog No. A3691 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2073 Background
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Galectin 4/LGALS4 (P56470). Sequence MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAA Gene ID Swiss Prot Synonyms GAL4; L36LBP Calculated MW 36kDa Observed MW 35kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HT-29, Rat large intestine Cellular location Cytosol, extracellular space, plasma membrane 
Western blot analysis of extracts of various cell lines, using Galectin 4/LGALS4 Rabbit mAb (A3691) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded human appendix using Galectin 4/LGALS4 Rabbit mAb (A3691) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse colon using Galectin 4/LGALS4 Rabbit mAb (A3691) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of rat rectum using Galectin 4/LGALS4 Rabbit mAb (A3691) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of human colon carcinoma using Galectin 4/LGALS4 Rabbit mAb (A3691) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse large intestine using Galectin 4/LGALS4 Rabbit mAb (A3691) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Galectin 4/LGALS4 (P56470). Isotype IgG