быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Histone H2A Rabbit mAb (A3692)
- Описание
- Характеристики
-
Overview
Product name Histone H2A Rabbit mAb Catalog No. A3692 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2072 Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2A (P04908). Sequence MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGR Gene ID Swiss Prot Synonyms H2A.1; H2A.2; H2A/a; H2AC4; H2AFA; HIST1H2AE Calculated MW 14kDa Observed MW 14kDa Applications
Reactivity Human, Mouse, Rat, Other (Wide Range) Tested applications WB IHC-P IP Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:100 - 1:500
- IP 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunoprecipitation Positive samples HeLa, HepG2, Jurkat, Mouse spleen, Mouse thymus, Rat liver Cellular location Chromosome, Nucleus Customer validation Co-IP( Arabidopsis)
WB(Mus musculus, Homo sapiens)
Western blot analysis of extracts of various cell lines, using Histone H2A Rabbit mAb (A3692) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of Rat liver, using Histone H2A Rabbit mAb (A3692) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry of paraffin-embedded human brain using Histone H2A Rabbit mAb (A3692) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human breast using Histone H2A Rabbit mAb (A3692) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human colon using Histone H2A Rabbit mAb (A3692) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human thyroid cancer using Histone H2A Rabbit mAb (A3692) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse spleen using Histone H2A Rabbit mAb (A3692) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded rat colon using Histone H2A Rabbit mAb (A3692) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded rat liver using Histone H2A Rabbit mAb (A3692) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg Histone H2A antibody (A3692). Western blot was performed from the immunoprecipitate using Histone H2A antibody (A3692) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса, Другое (Широкий ассортимент) Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2A (P04908). Isotype IgG