быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Syntaxin 3 Rabbit mAb (A3712)
- Описание
- Характеристики
-
Overview
Product name Syntaxin 3 Rabbit mAb Catalog No. A3712 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2081 Background
The gene is a member of the syntaxin family. The encoded protein is targeted to the apical membrane of epithelial cells where it forms clusters and is important in establishing and maintaining polarity necessary for protein trafficking involving vesicle fusion and exocytosis. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Syntaxin 3 (Q13277). Sequence KHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSGIIDSQISKQALSEIEGRHKD Gene ID Swiss Prot Synonyms MVID2; STX3A; DIAR12; RDMVID Calculated MW 33kDa Observed MW 35kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HT-29, 293T, PC-12 Cellular location Membrane, Single-pass type IV membrane protein 
Western blot analysis of extracts of various cell lines, using Syntaxin 3 Rabbit mAb (A3712) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded rat kidney using Syntaxin 3 Rabbit mAb (A3712) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using Syntaxin 3 Rabbit mAb (A3712) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Syntaxin 3 (Q13277). Isotype IgG