быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Kaiso/ZBTB33 Rabbit mAb (A3770)
- Описание
- Характеристики
-
Overview
Product name Kaiso/ZBTB33 Rabbit mAb Catalog No. A3770 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2086 Background
This gene encodes a transcriptional regulator with bimodal DNA-binding specificity, which binds to methylated CGCG and also to the non-methylated consensus KAISO-binding site TCCTGCNA. The protein contains an N-terminal POZ/BTB domain and 3 C-terminal zinc finger motifs. It recruits the N-CoR repressor complex to promote histone deacetylation and the formation of repressive chromatin structures in target gene promoters. It may contribute to the repression of target genes of the Wnt signaling pathway, and may also activate transcription of a subset of target genes by the recruitment of catenin delta-2 (CTNND2). Its interaction with catenin delta-1 (CTNND1) inhibits binding to both methylated and non-methylated DNA. It also interacts directly with the nuclear import receptor Importin-α2 (also known as karyopherin alpha2 or RAG cohort 1), which may mediate nuclear import of this protein. Alternatively spliced transcript variants encoding the same protein have been identified.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 573-672 of human Kaiso/ZBTB33 (Q86T24). Sequence HSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSSTIPAMKDDGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQENDSIFKQNVTDGSTEFEFIIPESY Gene ID Swiss Prot Synonyms ZNF348; ZNF-kaiso Calculated MW 74KDa Observed MW 80kDa Applications
Reactivity Human, Rat Tested applications WB IF/ICC IP Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples A-549, SH-SY5Y, Rat brain Cellular location cytosol, nucleolus, nucleoplasm, nucleus, plasma membrane 
Western blot analysis of extracts of various cell lines, using Kaiso/ZBTB33 Rabbit mAb (A3770) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of HeLa cells using Kaiso/ZBTB33 Rabbit mAb (A3770) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunoprecipitation analysis of 300 μg extracts of A-549 cells using 3 μg Kaiso/ZBTB33 antibody (A3770). Western blot was performed from the immunoprecipitate using Kaiso/ZBTB33 antibody (A3770) at a dilution of 1:1000.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 573-672 of human Kaiso/ZBTB33 (Q86T24). Isotype IgG







