быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
BAF57/SMARCE1 Rabbit mAb (A3814)
- Описание
- Характеристики
-
Overview
Product name BAF57/SMARCE1 Rabbit mAb Catalog No. A3814 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0839 Background
The protein encoded by this gene is part of the large ATP-dependent chromatin remodeling complex SWI/SNF, which is required for transcriptional activation of genes normally repressed by chromatin. The encoded protein, either alone or when in the SWI/SNF complex, can bind to 4-way junction DNA, which is thought to mimic the topology of DNA as it enters or exits the nucleosome. The protein contains a DNA-binding HMG domain, but disruption of this domain does not abolish the DNA-binding or nucleosome-displacement activities of the SWI/SNF complex. Unlike most of the SWI/SNF complex proteins, this protein has no yeast counterpart.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2-100 of human BAF57/SMARCE1 (NP_003070.3). Sequence SKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKII Gene ID Swiss Prot Synonyms CSS5; BAF57 Calculated MW 47kDa Observed MW 55kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Mouse spinal cord, Mouse brain, Rat brain, HeLa, MCF7, Jurkat Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using BAF57/SMARCE1 Rabbit mAb (A3814) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of various cell lines, using BAF57/SMARCE1 Rabbit mAb (A3814) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunofluorescence analysis of NIH-3T3 cells using BAF57/SMARCE1 Rabbit mAb (A3814) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using BAF57/SMARCE1 Rabbit mAb (A3814) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2-100 of human BAF57/SMARCE1 (NP_003070.3). Isotype IgG