быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MYLK Rabbit mAb (A3835)
- Описание
- Характеристики
-
Overview
Product name MYLK Rabbit mAb Catalog No. A3835 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0842 Background
This gene, a muscle member of the immunoglobulin gene superfamily, encodes myosin light chain kinase which is a calcium/calmodulin dependent enzyme. This kinase phosphorylates myosin regulatory light chains to facilitate myosin interaction with actin filaments to produce contractile activity. This gene encodes both smooth muscle and nonmuscle isoforms. In addition, using a separate promoter in an intron in the 3' region, it encodes telokin, a small protein identical in sequence to the C-terminus of myosin light chain kinase, that is independently expressed in smooth muscle and functions to stabilize unphosphorylated myosin filaments. A pseudogene is located on the p arm of chromosome 3. Four transcript variants that produce four isoforms of the calcium/calmodulin dependent enzyme have been identified as well as two transcripts that produce two isoforms of telokin. Additional variants have been identified but lack full length transcripts.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1800-1900 of human MYLK (Q15746). Sequence VAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE Gene ID Swiss Prot Synonyms KRP; AAT7; MLCK; MLCK1; MMIHS; MYLK1; MMIHS1; MYLK-L; smMLCK; MLCK108; MLCK210; MSTP083 Calculated MW 211kDa Observed MW 130kDa/140kDa Applications
Reactivity Human, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples PC-3, RD, Rat large intestine Cellular location Cell projection, Cleavage furrow, Cytoplasm, cytoskeleton, lamellipodium Customer validation WB(Mus musculus, Homo sapiens)

Western blot analysis of extracts of various cell lines, using MYLK Rabbit mAb (A3835) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1800-1900 of human MYLK (Q15746). Isotype IgG







