быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PKA RIIα (PRKAR2A) Rabbit mAb (A3889)
- Описание
- Характеристики
-
Overview
Product name PKA RIIα (PRKAR2A) Rabbit mAb Catalog No. A3889 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0860 Background
cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is one of the regulatory subunits. This subunit can be phosphorylated by the activated catalytic subunit. It may interact with various A-kinase anchoring proteins and determine the subcellular localization of cAMP-dependent protein kinase. This subunit has been shown to regulate protein transport from endosomes to the Golgi apparatus and further to the endoplasmic reticulum (ER).Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 312-404 of human PKA RIIα (PRKAR2A) (P13861). Sequence SRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ Gene ID Swiss Prot Synonyms PKR2 Calculated MW 46kDa Observed MW 50kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, HepG2 Cellular location Cell membrane, Cytoplasm Customer validation WB(Mus musculus, Rattus norvegicus)

Western blot analysis of extracts of various cell lines, using PKA RIIα (PRKAR2A) Rabbit mAb (A3889) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 312-404 of human PKA RIIα (PRKAR2A) (P13861). Isotype IgG







