быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SGK1 Rabbit mAb (A3936)
- Описание
- Характеристики
-
Overview
Product name SGK1 Rabbit mAb Catalog No. A3936 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0868 Background
This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. High levels of expression of this gene may contribute to conditions such as hypertension and diabetic nephropathy. Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SGK1 (O00141). Sequence MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHF Gene ID Swiss Prot Synonyms SGK Calculated MW 48kDa/49kDa/51kDa/60kDa Observed MW 60kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples BxPC-3, Mouse brain Cellular location Cell membrane, Cytoplasm, Endoplasmic reticulum membrane, Mitochondrion, Nucleus 
Western blot analysis of extracts of various cell lines, using SGK1 Rabbit mAb (A3936) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SGK1 (O00141). Isotype IgG