быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Integrin alpha 4 (ITGA4/CD49d) Rabbit mAb (A4054)
- Описание
- Характеристики
-
Overview
Product name Integrin alpha 4 (ITGA4/CD49d) Rabbit mAb Catalog No. A4054 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0888 Background
The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 4 subunit. This subunit associates with a beta 1 or beta 7 subunit to form an integrin that may play a role in cell motility and migration. This integrin is a therapeutic target for the treatment of multiple sclerosis, Crohn's disease and inflammatory bowel disease. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 933-1032 of human Integrin alpha 4 (ITGA4/CD49d) (P13612). Sequence ALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKRYFTIVIISSSLLLGLIVLLLISYVMWKAGFFKRQYKSILQEENRRDSWSYINSKSNDD Gene ID Swiss Prot Synonyms IA4; CD49D Calculated MW 115kDa Observed MW 70kDa/140kDa/150kDa/200kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Jurkat, Mouse spleen, Rat spleen Cellular location Membrane, Single-pass type I membrane protein 
Western blot analysis of extracts of various cell lines, using Integrin alpha 4 (ITGA4/CD49d) (ITGA4/CD49d) Rabbit mAb (A4054) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded mouse testis using Integrin alpha 4 (ITGA4/CD49d) (ITGA4/CD49d) Rabbit mAb (A4054) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 933-1032 of human Integrin alpha 4 (ITGA4/CD49d) (P13612). Isotype IgG