быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SMMHC/MYH11 Rabbit mAb (A4064)
- Описание
- Характеристики
-
Overview
Product name SMMHC/MYH11 Rabbit mAb Catalog No. A4064 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51911 Background
The protein encoded by this gene is a smooth muscle myosin belonging to the myosin heavy chain family. The gene product is a subunit of a hexameric protein that consists of two heavy chain subunits and two pairs of non-identical light chain subunits. It functions as a major contractile protein, converting chemical energy into mechanical energy through the hydrolysis of ATP. A chromosomal rearrangement involving this gene is associated with acute myeloid leukemia of the M4Eo subtype. Mutations in this gene are associated with visceral myopathy, megacystis-microcolon-intestinal hypoperistalsis syndrome 2, and familial thoracic aortic aneurysm 4.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1160-1313 of human SMMHC/MYH11 (NP_002465.1). Sequence DSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASL Gene ID Swiss Prot Synonyms AAT4; FAA4; SMHC; SMMHC; VSCM2; SMMS-1 Calculated MW 227kDa Observed MW 250kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:2000 - 1:10000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples Mouse lung, Rat lung Cellular location Cytoplasm, Melanosome Customer validation WB(Mus musculus, Homo sapiens, Rattus norvegicus)
IF(Sus scrofa)
Western blot analysis of extracts of Mouse lung, using SMMHC/SMMHC/MYH11 Rabbit mAb (A4064) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Western blot analysis of extracts of Rat lung, using SMMHC/SMMHC/MYH11 Rabbit mAb (A4064) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
Immunohistochemistry of paraffin-embedded human colon carcinoma using SMMHC/MYH11 Rabbit mAb (A4064) at dilution of 1:8000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human colon using SMMHC/MYH11 Rabbit mAb (A4064) at dilution of 1:8000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human placenta using SMMHC/MYH11 Rabbit mAb (A4064) at dilution of 1:8000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse kidney using SMMHC/MYH11 Rabbit mAb (A4064) at dilution of 1:8000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of human colon using SMMHC/MYH11 Rabbit mAb (A4064) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse colon using SMMHC/MYH11 Rabbit mAb (A4064) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of rat colon using SMMHC/MYH11 Rabbit mAb (A4064) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1160-1313 of human SMMHC/MYH11 (NP_002465.1). KO Validated Validated Isotype IgG