быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Calpain 2 Rabbit mAb (A4066)
- Описание
- Характеристики
-
Overview
Product name Calpain 2 Rabbit mAb Catalog No. A4066 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0891 Background
The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 2. Multiple heterogeneous transcriptional start sites in the 5' UTR have been reported. Two transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 600-700 of human Calpain 2 (P17655). Sequence LWTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDQLIIDFDNFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVL Gene ID Swiss Prot Synonyms CANP2; mCANP; CANPL2; CANPml Calculated MW 80kDa Observed MW 80kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, Mouse lung, Mouse brain, Mouse kidney, Rat lung, Rat brain, Rat kidney Cellular location Cell membrane, Cytoplasm Customer validation WB(Rattus norvegicus)
IF(Homo sapiens)

Western blot analysis of extracts of various cell lines, using Calpain 2 Rabbit mAb (A4066) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 600-700 of human Calpain 2 (P17655). Isotype IgG







