быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
RBPJK Rabbit mAb (A4081)
- Описание
- Характеристики
-
Overview
Product name RBPJK Rabbit mAb Catalog No. A4081 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0894 Background
The protein encoded by this gene is a transcriptional regulator important in the Notch signaling pathway. The encoded protein acts as a repressor when not bound to Notch proteins and an activator when bound to Notch proteins. It is thought to function by recruiting chromatin remodeling complexes containing histone deacetylase or histone acetylase proteins to Notch signaling pathway genes. Several transcript variants encoding different isoforms have been found for this gene, and several pseudogenes of this gene exist on chromosome 9.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RBPJK (Q06330). Sequence CAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVST Gene ID Swiss Prot Synonyms SUH; csl; AOS3; CBF1; KBF2; CBF-1; RBP-J; RBPJK; IGKJRB; RBP-JK; RBPSUH; IGKJRB1; RBP-J kappa Calculated MW 56kDa Observed MW 67kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, MCF7, U-251MG, Mouse testis Cellular location Cytoplasm, Nucleus Customer validation WB(Mus musculus)
Western blot analysis of extracts of various cell lines, using RBPJK Rabbit mAb (A4081) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using RBPJK Rabbit mAb (A4081) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human lung squamous carcinoma tissue using RBPJK Rabbit mAb (A4081) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RBPJK (Q06330). Isotype IgG