быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
JAB1/CSN5/COPS5 Rabbit mAb (A4087)
- Описание
- Характеристики
-
Overview
Product name JAB1/CSN5/COPS5 Rabbit mAb Catalog No. A4087 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0895 Background
The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human JAB1/CSN5/COPS5 (Q92905). Sequence MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPV Gene ID Swiss Prot Synonyms CSN5; JAB1; SGN5; MOV-34 Calculated MW 38kDa Observed MW 35kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC IP ChIP Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
- ChIP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, 293T, Mouse testis, Mouse kidney, Rat testis, Rat brain Cellular location Cytoplasm, Cytoplasmic vesicle, Nucleus, perinuclear region, secretory vesicle, synaptic vesicle Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using JAB1/CSN5/COPS5 Rabbit mAb (A4087) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded rat testis using JAB1/CSN5/COPS5 Rabbit mAb (A4087) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon using JAB1/CSN5/COPS5 Rabbit mAb (A4087) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse testis using JAB1/CSN5/COPS5 Rabbit mAb (A4087) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH-3T3 cells using JAB1/CSN5/COPS5 Rabbit mAb (A4087) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using JAB1/CSN5/COPS5 Rabbit mAb (A4087) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Chromatin immunoprecipitation analysis of extracts of HeLa cells, using JAB1/CSN5/COPS5 antibody (A4087) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human JAB1/CSN5/COPS5 (Q92905). Isotype IgG