быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SRSF1/SF2/ASF Rabbit mAb (A4091)
- Описание
- Характеристики
-
Overview
Product name SRSF1/SF2/ASF Rabbit mAb Catalog No. A4091 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51453 Background
This gene encodes a member of the arginine/serine-rich splicing factor protein family. The encoded protein can either activate or repress splicing, depending on its phosphorylation state and its interaction partners. Multiple transcript variants have been found for this gene. There is a pseudogene of this gene on chromosome 13.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SRSF1/SF2/ASF (NP_008855.1). Sequence GGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSP Gene ID Swiss Prot Synonyms ASF; SF2; SFRS1; SF2p33; SRp30a Calculated MW 28kDa Observed MW 33kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, Hep G2, MCF7, SH-SY5Y, Mouse thymus, Rat thymus Cellular location Cytoplasm, Nucleus speckle Customer validation WB(Mus musculus)
Western blot analysis of various lysates, using SRSF1/SF2/ASF Rabbit mAb (A4091) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human colon using SRSF1/SF2/ASF Rabbit mAb (A4091) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using SRSF1/SF2/ASF Rabbit mAb (A4091) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse brain using SRSF1/SF2/ASF Rabbit mAb (A4091) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat kidney using SRSF1/SF2/ASF Rabbit mAb (A4091) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SRSF1/SF2/ASF (NP_008855.1). Isotype IgG