быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Monoamine Oxidase A (MAOA) Rabbit mAb (A4105)
- Описание
- Характеристики
-
Overview
Product name Monoamine Oxidase A (MAOA) Rabbit mAb Catalog No. A4105 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0900 Background
This gene is one of two neighboring gene family members that encode mitochondrial enzymes which catalyze the oxidative deamination of amines, such as dopamine, norepinephrine, and serotonin. Mutation of this gene results in Brunner syndrome. This gene has also been associated with a variety of other psychiatric disorders, including antisocial behavior. Alternatively spliced transcript variants encoding multiple isoforms have been observed.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 428-527 of human Monoamine Oxidase A (MAOA) (P21397). Sequence GRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS Gene ID Swiss Prot Synonyms BRNRS; MAO-A Calculated MW 60kDa Observed MW 60kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HepG2, Mouse lung, Mouse brain, Mouse kidney, Rat liver Cellular location Mitochondrion outer membrane, Single-pass type IV membrane protein Customer validation WB(Rattus norvegicus, Mus musculus)
Western blot analysis of extracts of various cell lines, using Monoamine Oxidase A (MAOA) Rabbit mAb (A4105) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of Rat liver, using Monoamine Oxidase A (MAOA) Rabbit mAb (A4105) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded human colon using Monoamine Oxidase A (MAOA) Rabbit mAb (A4105) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 428-527 of human Monoamine Oxidase A (MAOA) (P21397). Isotype IgG