быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Prolactin Receptor Rabbit mAb (A4121)
- Описание
- Характеристики
-
Overview
Product name Prolactin Receptor Rabbit mAb Catalog No. A4121 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2123 Background
This gene encodes a receptor for the anterior pituitary hormone, prolactin, and belongs to the type I cytokine receptor family. Prolactin-dependent signaling occurs as the result of ligand-induced dimerization of the prolactin receptor. Several alternatively spliced transcript variants encoding different membrane-bound and soluble isoforms have been described for this gene, which may function to modulate the endocrine and autocrine effects of prolactin in normal tissue and cancer.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Prolactin Receptor (P16471). Sequence MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYI Gene ID Swiss Prot Synonyms HPRL; MFAB; hPRLrI; RI-PRLR Calculated MW 70kDa Observed MW 95kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Hep G2, BT-474, MCF7 Cellular location Cell surface, Endosome lumen, External side of plasma membrane, Extracellular region, Plasma membrane 
Western blot analysis of extracts of various cell lines, using Prolactin Receptor Rabbit mAb (A4121) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Prolactin Receptor (P16471). Isotype IgG