быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
GLUT3/SLC2A3 Rabbit mAb (A4137)
- Описание
- Характеристики
-
Overview
Product name GLUT3/SLC2A3 Rabbit mAb Catalog No. A4137 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0917 Background
Enables dehydroascorbic acid transmembrane transporter activity; glucose binding activity; and glucose transmembrane transporter activity. Involved in glucose import across plasma membrane and transport across blood-brain barrier. Is integral component of plasma membrane. Biomarker of Alzheimer's disease; acanthosis nigricans; diabetes mellitus; and type 2 diabetes mellitus.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GLUT3/SLC2A3 (P11169). Sequence MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFINKTLTDKGNAPPSEVLLTSLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLL Gene ID Swiss Prot Synonyms GLUT3 Calculated MW 54kDa Observed MW 48-60kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IP Recommended dilution - WB 1:500 - 1:2000
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples HepG2, Jurkat, SH-SY5Y, Mouse testis, Mouse brain, Rat testis, Rat brain Cellular location Cell membrane, Multi-pass membrane protein, Perikaryon, Cell projection Customer validation IP(Homo sapiens,Mus musculus)
WB(Homo sapiens,Mus musculus)
Western blot analysis of extracts of various cell lines, using GLUT3/SLC2A3 Rabbit mAb (A4137) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunoprecipitation analysis of 600 μg extracts of Mouse brain using 3 μg GLUT3/SLC2A3 antibody (A4137). Western blot was performed from the immunoprecipitate using GLUT3/SLC2A3 antibody (A4137) at a dilution of 1:1000.
-
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GLUT3/SLC2A3 (P11169). Isotype IgG