быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Prostatic Acid Phosphatase (ACPP) Rabbit mAb (A4138)
- Описание
- Характеристики
-
Overview
Product name Prostatic Acid Phosphatase (ACPP) Rabbit mAb Catalog No. A4138 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2124 Background
This gene encodes an enzyme that catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is synthesized under androgen regulation and is secreted by the epithelial cells of the prostate gland. An alternatively spliced transcript variant encoding a longer isoform has been found for this gene. This isoform contains a transmembrane domain and is localized in the plasma membrane-endosomal-lysosomal pathway.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Prostatic Acid Phosphatase(PAP/ACPP) (P15309). Sequence MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLVFRHGDRSPIDTFPTDPIKESSWPQGFGQLTQLGMEQHYELGEYIRKRYRKFLNESYKHE Gene ID Swiss Prot Synonyms ACPP; 5'-NT; ACP-3; TM-PAP Calculated MW 45kDa Observed MW 45kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse liver, Rat liver Cellular location cytosol, extracellular exosome, extracellular space, filopodium, lysosome, nucleus, plasma membrane 
Western blot analysis of extracts of various cell lines, using Prostatic Acid Phosphatase (ACPP) (PAP/ACPP) Rabbit mAb (A4138) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Prostatic Acid Phosphatase(PAP/ACPP) (P15309). Isotype IgG