быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
BMP15 Rabbit mAb (A4148)
- Описание
- Характеристики
-
Overview
Product name BMP15 Rabbit mAb Catalog No. A4148 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0907 Background
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate subunits of a disulfide-linked homodimer, or alternatively, a heterodimer, with the related protein, growth differentiation factor 9 (GDF9). This protein plays a role in oocyte maturation and follicular development, through activation of granulosa cells. Defects in this gene are the cause of ovarian dysgenesis and are associated with premature ovarian failure.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 293-392 of human BMP15 (O95972). Sequence LHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR Gene ID Swiss Prot Synonyms ODG2; POF4; GDF9B Calculated MW 45kDa Observed MW 50kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples SKOV3, A-431, Mouse lung, Mouse ovary, Mouse kidney, Rat ovary Cellular location Secreted 
Western blot analysis of extracts of various cell lines, using BMP15 Rabbit mAb (A4148) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Western blot analysis of extracts of Rat ovary, using BMP15 Rabbit mAb (A4148) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 293-392 of human BMP15 (O95972). Isotype IgG