быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ESRRA Rabbit mAb (A4176)
- Описание
- Характеристики
-
Overview
Product name ESRRA Rabbit mAb Catalog No. A4176 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0919 Background
The protein encoded by this gene is a nuclear receptor that is most closely related to the estrogen receptor. This protein acts as a site-specific transcription factor and interacts with members of the PGC-1 family of transcription cofactors to regulate the expression of most genes involved in cellular energy production as well as in the process of mitochondrial biogenesis. A processed pseudogene of ESRRA is located on chromosome 13q12.1.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ESRRA (P11474). Sequence MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAGPGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACK Gene ID Swiss Prot Synonyms ERR1; ERRa; ESRL1; NR3B1; ERRalpha Calculated MW 46kDa Observed MW 48-50kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, Mouse brain Cellular location Nucleus, Cytoplasm Customer validation ChIP(Mus musculus)
Western blot analysis of extracts of various cell lines, using ESRRA Rabbit mAb (A4176) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ESRRA (P11474). Isotype IgG