быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MRE11 Rabbit mAb (A4222)
- Описание
- Характеристики
-
Overview
Product name MRE11 Rabbit mAb Catalog No. A4222 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0931 Background
This gene encodes a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself, the protein has 3' to 5' exonuclease activity and endonuclease activity. The protein forms a complex with the RAD50 homolog; this complex is required for nonhomologous joining of DNA ends and possesses increased single-stranded DNA endonuclease and 3' to 5' exonuclease activities. In conjunction with a DNA ligase, this protein promotes the joining of noncomplementary ends in vitro using short homologies near the ends of the DNA fragments. This gene has a pseudogene on chromosome 3. Alternative splicing of this gene results in two transcript variants encoding different isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human MRE11 (P49959). Sequence RHREQKEKTGEEINFGKLITKPSEGTTLRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFLKERHIDALEDKIDEE Gene ID Swiss Prot Synonyms ATLD; HNGS1; MRE11A; MRE11B Calculated MW 81kDa Observed MW 81kDa Applications
Reactivity Human, Mouse Tested applications WB IP ChIP Recommended dilution - WB 1:500 - 1:2000
- ChIP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, Mouse testis Cellular location Nucleus Customer validation (NCl-N87 、RAMOS 、293T 、PC-3 、Hela)
Western blot analysis of extracts of various cell lines, using MRE11 Rabbit mAb (A4222) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Chromatin immunoprecipitation analysis of extracts of LNCaP cells, using Mre11 antibody (A4222) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human MRE11 (P49959). Isotype IgG