быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Reptin/RUVBL2 Rabbit mAb (A4227)
- Описание
- Характеристики
-
Overview
Product name Reptin/RUVBL2 Rabbit mAb Catalog No. A4227 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0933 Background
This gene encodes the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this gene product has both ATPase and DNA helicase activities. This gene is physically linked to the CGB/LHB gene cluster on chromosome 19q13.3, and is very close (55 nt) to the LHB gene, in the opposite orientation.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Reptin/RUVBL2 (Q9Y230). Sequence LLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAF Gene ID Swiss Prot Synonyms RVB2; TIH2; ECP51; TIP48; CGI-46; ECP-51; INO80J; REPTIN; TIP49B; TAP54-beta Calculated MW 51kDa Observed MW 50kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, HepG2, Mouse testis, Mouse thymus Cellular location Cytoplasm, Membrane, Nucleus, Nucleus matrix, nucleoplasm 
Western blot analysis of extracts of various cell lines, using Reptin/RUVBL2 Rabbit mAb (A4227) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Western blot analysis of extracts of various cell lines, using Reptin/RUVBL2 Rabbit mAb (A4227) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Reptin/RUVBL2 (Q9Y230). Isotype IgG