быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Calbindin Rabbit mAb (A4284)
- Описание
- Характеристики
-
Overview
Product name Calbindin Rabbit mAb Catalog No. A4284 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0953 Background
The protein encoded by this gene is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. Originally described as a 27 kDa protein, it is now known to be a 28 kDa protein. It contains four active calcium-binding domains, and has two modified domains that are thought to have lost their calcium binding capability. This protein is thought to buffer entry of calcium upon stimulation of glutamate receptors. Depletion of this protein was noted in patients with Huntington disease.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Calbindin (P05937). Sequence MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSC Gene ID Swiss Prot Synonyms CALB; D-28K Calculated MW 30kDa Observed MW 28kDa Applications
Reactivity Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Mouse brain, Rat kidney Cellular location axon, calyx of Held, cytosol, dendrite, dendritic spine, extracellular exosome, GABA-ergic synapse, glutamatergic synapse, hippocampal mossy fiber to CA3 synapse, neuron projection, nucleus, postsynaptic cytosol, presynaptic cytosol, synapse, terminal bouton 
Western blot analysis of extracts from various cell lines, using Calbindin Rabbit mAb (A4284) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Confocal imaging of human kidney using Calbindin Rabbit mAb (A4284, dilution 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 40x.Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Calbindin (P05937). Isotype IgG